General Information

  • ID:  hor006653
  • Uniprot ID:  P84118
  • Protein name:  Bursicon
  • Gene name:  burs
  • Organism:  Periplaneta americana (American cockroach) (Blatta americana)
  • Family:  NA
  • Source:  Animal
  • Expression:  Central nervous system. Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with pburs in the large bilateral lateral neurosecretory neurons of the first three unfused abdominal ganglia and in all anterior bilateral cell pairs in the thoracic
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Periplaneta (genus), Blattinae (subfamily), Blattidae (family), Blattoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005507 copper ion binding; GO:0046872 metal ion binding
  • GO BP:  GO:0006801 superoxide metabolic process; GO:0007165 signal transduction; GO:0007593 chitin-based cuticle sclerotization; GO:0048067 cuticle pigmentation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GTVFFDQDSPDSPVKVTGEVTGLQKHGFHIHEFGDNTNMSADGSSYLQVSGSKLTQEGQASMEVKGNAGARVAXGVVGIAK
  • Length:  81(1-81)
  • Propeptide:  GTVFFDQDSPDSPVKVTGEVTGLQKHGFHIHEFGDNTNMSADGSSYLQVSGSKLTQEGQASMEVKGNAGARVAXGVVGIAK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006653_AF2.pdbhor006653_ESM.pdb

Physical Information

Mass: 980023 Formula: C357H558N102O120S2
Absent amino acids: CW Common amino acids: G
pI: 5.51 Basic residues: 9
Polar residues: 29 Hydrophobic residues: 24
Hydrophobicity: -34.94 Boman Index: -11558
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 63.7
Instability Index: 3444.69 Extinction Coefficient cystines: 1490
Absorbance 280nm: 18.63

Literature

  • PubMed ID:  10528407
  • Title:  Antisera against Periplaneta americana Cu,Zn-superoxide dismutase (SOD): separation of the neurohormone bursicon from SOD, and immunodetection of SOD in the central nervous system.
  • PubMed ID:  12271490
  • Title:  Cellular localization of bursicon using antisera against partial peptide
  • PubMed ID:  15703293
  • Title: